PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0002s0172.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family Trihelix
Protein Properties Length: 270aa    MW: 30781.4 Da    PI: 6.9456
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0002s0172.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix42.91.3e-131488276
             trihelix  2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsess 76
                         W+  e l+L +a+re +++  + + +k +W ++ ++++e+ ++rs +qCk++w  ++ ++kk+ e ++   s++ 
  Mapoly0002s0172.1.p 14 WSVTECLVLQAAKREENDKHDKHRGAKEKWLAIEDYCWEHDVHRSGQQCKDRWYRMALEFKKVYEYQRAIPSGKP 88
                         ***************************************************************999988654444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.8641070IPR017877Myb-like domain
PfamPF138372.5E-91293No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MEEREGRVYK KTNWSVTECL VLQAAKREEN DKHDKHRGAK EKWLAIEDYC WEHDVHRSGQ  60
QCKDRWYRMA LEFKKVYEYQ RAIPSGKPSF WQLSGSERKE ARLPIVFHQE IYDAMVDWYL  120
NSKPGNGNLV IDTSVPSPAD EGHHDASNGN CSGTDEGESD DRSGHSMGNK NKRRKTIAKA  180
ALSLASMVER SGDVTSKALL ECEDRKDQRL EKQLEFNERL AVRQLEANER LALKQMDANE  240
RIASGYINAI INLADALRSL STPRSAEPQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18811637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35640.13e-17Trihelix family protein